cathepsin G
Functional Attributes in Pathways
-
Substrates : 46 entries in CutDB for S01.133
Ext
-
A-type flagellin
-
Angiotensinogen preproprotein
-
chemokine (c-x-c motif) ligand 12 (stromal cell-derived factor 1) isoform beta
-
chemokine (C-X-C motif) receptor 4 isoform a
-
Coagulation factor ii (thrombin) receptor-like 1 precursor
-
coagulation factor II (thrombin) receptor-like 1 precursor
-
coagulation factor II (thrombin) receptor-like 3 precursor
-
coagulation factor II receptor precursor
-
Coagulation factor ii receptor precursor
-
coagulation factor V precursor
-
coagulation factor X (Homo sapiens)
-
Complement component 3 precursor
-
flagellin
-
Heparin cofactor ii precursor
-
IgG1 heavy chain (hinge region)
-
Insulin-like growth factor binding protein 3 isoform b precursor
-
integrin beta chain, beta 3 precursor
-
interleukin 1, beta proprotein [Homo sapiens]
-
myelin basic protein isoform 1
-
plasminogen activator, urokinase receptor isoform 1 precursor
-
plasminogen activator, urokinase receptor isoform 2 precursor
-
plasminogen activator, urokinase receptor isoform 3 precursor
-
platelet glycoprotein Ib alpha polypeptide precursor
-
platelet glycoprotein Ibalpha (Homo sapiens)
-
Poly (adp-ribose) polymerase family, member 1
-
pro-platelet basic protein precursor
-
selectin P ligand
-
serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 1
-
surfactant protein A1
-
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a2 isoform a
-
thrombospondin 1 precursor
-
urokinase plasminogen activator preproprotein
-
vascular cell adhesion molecule 1 isoform b precursor
-
Substrate Specificity -- Under development
-
Inhibitors -- Under development
-
Pathways -- Under development
Recent News and Literature
- Cathepsin G enhances mammary...Cancer Res. 2008 Jul 15;68(14):5803-11.
- The biochemical and functional...Crit Rev Food Sci Nutr. 2008 Jan;48(1):94-118.
- Proteolysis of purified IgGs...Mol Immunol. 2008 Apr;45(7):1837-46. Epub 2007 Dec 21.
- The Caenorhabditis elegans muscle...Biochemistry 2006 Apr 11;45(14): p4474-80
- Effect of various genetic...Clin Appl Thromb Hemost 2006 Jan;12(1): p47-54
- Gingival tissue and crevicular...J Dent Res 2006 Jan;85(1): p59-63
- Effects of elastase and cathepsin...Biol Chem 2005 Aug;386(8): p801-11
- Induction of multicellular 3-D spheroids...Cancer Sci 2005 Sep;96(9): p560-70
- In vitro induction of myeloid...Clin Cancer Res 2005 Jun 15;11(12): p4495-503
- Hyperforin inhibits cancer invasion...Cancer Res 2004 Sep 1;64(17): p6225-32
- Altered glucose metabolism and proteolysis...Gut 2004 Aug;53(8): p1159-66
- Synthesis and biological evaluation...J Med Chem 2003 Aug 28;46(18): p3900-13
- Identification of proteases involved...J Biol Chem 2003 Apr 18;278(16): p14002-12
- Dual-label immunoassay for simultaneous...Clin Chem. 2003 Jan;49(1):97-103.
- Few smokers develop COPD....Respir Med 2002 Aug;96(8): p615-24
- Secretory leucoprotease inhibitor prevents...J Biol Chem 2002 Sep 13;277(37): p33648-53
- Secretory leukocyte protease inhibitor...J Biol Chem 2002 Aug 16;277(33): p29999-30009
- Antioxidant status and proteolytic-antiproteolytic...Folia Histochem Cytobiol 2001;39 Suppl 2:98-9
- (-)Epigallocatechin-3-gallate inhibits leukocyte elastase:...J Leukoc Biol 2002 Jan;71(1): p73-9
- SCCA2 inhibits TNF-mediated apoptosis...Eur J Biochem 2001 Nov;268(22): p5868-75
Structural Features
MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLGAHNIQ
RRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLR
EVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRT
TMRSFKLLDQMETPL
Cross annotation in other databases
cathepsin G in:
Gene Cards
- Diseases
- Expression
- SNP
- Drugs
Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS
Functional Attributes in Pathways
-
Substrates : 46 entries in CutDB for S01.133
Ext
- A-type flagellin
- Angiotensinogen preproprotein
- chemokine (c-x-c motif) ligand 12 (stromal cell-derived factor 1) isoform beta
- chemokine (C-X-C motif) receptor 4 isoform a
- Coagulation factor ii (thrombin) receptor-like 1 precursor
- coagulation factor II (thrombin) receptor-like 1 precursor
- coagulation factor II (thrombin) receptor-like 3 precursor
- coagulation factor II receptor precursor
- Coagulation factor ii receptor precursor
- coagulation factor V precursor
- coagulation factor X (Homo sapiens)
- Complement component 3 precursor
- flagellin
- Heparin cofactor ii precursor
- IgG1 heavy chain (hinge region)
- Insulin-like growth factor binding protein 3 isoform b precursor
- integrin beta chain, beta 3 precursor
- interleukin 1, beta proprotein [Homo sapiens]
- myelin basic protein isoform 1
- plasminogen activator, urokinase receptor isoform 1 precursor
- plasminogen activator, urokinase receptor isoform 2 precursor
- plasminogen activator, urokinase receptor isoform 3 precursor
- platelet glycoprotein Ib alpha polypeptide precursor
- platelet glycoprotein Ibalpha (Homo sapiens)
- Poly (adp-ribose) polymerase family, member 1
- pro-platelet basic protein precursor
- selectin P ligand
- serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 1
- surfactant protein A1
- SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a2 isoform a
- thrombospondin 1 precursor
- urokinase plasminogen activator preproprotein
- vascular cell adhesion molecule 1 isoform b precursor
- Substrate Specificity -- Under development
- Inhibitors -- Under development
- Pathways -- Under development
Recent News and Literature
- Cathepsin G enhances mammary...Cancer Res. 2008 Jul 15;68(14):5803-11.
- The biochemical and functional...Crit Rev Food Sci Nutr. 2008 Jan;48(1):94-118.
- Proteolysis of purified IgGs...Mol Immunol. 2008 Apr;45(7):1837-46. Epub 2007 Dec 21.
- The Caenorhabditis elegans muscle...Biochemistry 2006 Apr 11;45(14): p4474-80
- Effect of various genetic...Clin Appl Thromb Hemost 2006 Jan;12(1): p47-54
- Gingival tissue and crevicular...J Dent Res 2006 Jan;85(1): p59-63
- Effects of elastase and cathepsin...Biol Chem 2005 Aug;386(8): p801-11
- Induction of multicellular 3-D spheroids...Cancer Sci 2005 Sep;96(9): p560-70
- In vitro induction of myeloid...Clin Cancer Res 2005 Jun 15;11(12): p4495-503
- Hyperforin inhibits cancer invasion...Cancer Res 2004 Sep 1;64(17): p6225-32
- Altered glucose metabolism and proteolysis...Gut 2004 Aug;53(8): p1159-66
- Synthesis and biological evaluation...J Med Chem 2003 Aug 28;46(18): p3900-13
- Identification of proteases involved...J Biol Chem 2003 Apr 18;278(16): p14002-12
- Dual-label immunoassay for simultaneous...Clin Chem. 2003 Jan;49(1):97-103.
- Few smokers develop COPD....Respir Med 2002 Aug;96(8): p615-24
- Secretory leucoprotease inhibitor prevents...J Biol Chem 2002 Sep 13;277(37): p33648-53
- Secretory leukocyte protease inhibitor...J Biol Chem 2002 Aug 16;277(33): p29999-30009
- Antioxidant status and proteolytic-antiproteolytic...Folia Histochem Cytobiol 2001;39 Suppl 2:98-9
- (-)Epigallocatechin-3-gallate inhibits leukocyte elastase:...J Leukoc Biol 2002 Jan;71(1): p73-9
- SCCA2 inhibits TNF-mediated apoptosis...Eur J Biochem 2001 Nov;268(22): p5868-75
Structural Features
MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLGAHNIQ
RRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLR
EVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRT
TMRSFKLLDQMETPL
Cross annotation in other databases
cathepsin G in:
- Gene Cards
- Diseases
- Expression
- SNP
- Drugs
- Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS
© The PMAP Web Site is managed by The Center on Proteolytic Pathways at the Burnham Institute for Medical Research through a grant from the NIH Roadmap.
Copyright 2008. All rights reserved.
The Burnham Institute for Medical Research 10901 N. Torrey Pines Rd., La Jolla, CA 92037.
With problems, comments, or suggestions please contact: pmap_info@burnham.org