KLK3/PSA
Functional Attributes in Pathways
-
Substrates : 103 entries in CutDB for S01.162
Ext
-
serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
-
fibronectin 1 isoform 1 preproprotein
-
fibronectin 1 isoform 2 preproprotein
-
fibronectin 1 isoform 3 preproprotein
-
fibronectin 1 isoform 4 preproprotein
-
fibronectin 1 isoform 5 preproprotein
-
fibronectin 1 isoform 6 preproprotein
-
fibronectin 1 isoform 7 preproprotein
-
Insulin-like growth factor binding protein 3 isoform b precursor
-
insulin-like growth factor binding protein 4 precursor
-
kallikrein 2, prostatic isoform 1
-
parathyroid hormone-like hormone isoform 1 preproprotein
-
Parathyroid hormone-like hormone isoform 2 preproprotein
-
Plasminogen
-
Secretory leukocyte peptidase inhibitor precursor
-
Semenogelin i isoform a preproprotein
-
Semenogelin ii precursor
-
serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 1
-
u-plasminogen activator precursor
-
Substrate Specificity -- Under development
-
Inhibitors -- Under development
-
Pathways -- Under development
Recent News and Literature
- Total Prostate Specific Antigen...J Urol. 2008 Jun 10;.
- [-2]Proenzyme Prostate Specific Antigen...J Urol. 2008 Jun 10;.
- The Performance of Prostate...J Urol. 2008 Jun 10;.
- Highly specific detection of...BJU Int. 2008 Jun 11;.
- Pathologic stage T2a and...Prostate. 2008 Jun 9;.
- Associations of lower urinary...BJU Int. 2008 Jun 6;.
- [Prostate specific antigen: Utilization...Cancer Radiother. 2008 Jun 6;.
- An artificial neural network...BJU Int. 2008 Jun 3;.
- Association between serum prostate-specific...BJU Int. 2008 Jun 3;.
- Inverse Relationship Between Obesity...Urology. 2008 May 30;.
- The Comparability of Models...Eur Urol. 2008 May 22;.
- Quality of Life, Morbidity,...Clin Genitourin Cancer. 2008 Mar;6(1):46-52.
- Novel small molecule inhibitors...Prostate. 2008 May 23;.
- High Expression of KLK14...Tumour Biol. 2008;29(1):1-8. Epub 2008 May 23.
- Shorter CAG repeats in...Cancer Lett. 2008 May 19;.
- Detecting prostate cancer by...Eur J Clin Invest. 2008 Jun;38(6):430-7.
- Are prostate biopsies mandatory...Prostate. 2008 May 15;.
- Why determine only the...Ann Clin Biochem. 2008 May;45(Pt 3):270-4.
- Case records of the...N Engl J Med. 2008 May 15;358(20):2161-8.
- WHAT IS THE FUTURE...BJU Int. 2008 May 12;.
Structural Features
MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSL
FHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSI
EPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERP
SLYTKVVHYRKWIKDTIVANP
Cross annotation in other databases
KLK3/PSA in:
Gene Cards
- Diseases
- Expression
- SNP
- Drugs
Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS
Functional Attributes in Pathways
-
Substrates : 103 entries in CutDB for S01.162
Ext
- serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
- fibronectin 1 isoform 1 preproprotein
- fibronectin 1 isoform 2 preproprotein
- fibronectin 1 isoform 3 preproprotein
- fibronectin 1 isoform 4 preproprotein
- fibronectin 1 isoform 5 preproprotein
- fibronectin 1 isoform 6 preproprotein
- fibronectin 1 isoform 7 preproprotein
- Insulin-like growth factor binding protein 3 isoform b precursor
- insulin-like growth factor binding protein 4 precursor
- kallikrein 2, prostatic isoform 1
- parathyroid hormone-like hormone isoform 1 preproprotein
- Parathyroid hormone-like hormone isoform 2 preproprotein
- Plasminogen
- Secretory leukocyte peptidase inhibitor precursor
- Semenogelin i isoform a preproprotein
- Semenogelin ii precursor
- serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 1
- u-plasminogen activator precursor
- Substrate Specificity -- Under development
- Inhibitors -- Under development
- Pathways -- Under development
Recent News and Literature
- Total Prostate Specific Antigen...J Urol. 2008 Jun 10;.
- [-2]Proenzyme Prostate Specific Antigen...J Urol. 2008 Jun 10;.
- The Performance of Prostate...J Urol. 2008 Jun 10;.
- Highly specific detection of...BJU Int. 2008 Jun 11;.
- Pathologic stage T2a and...Prostate. 2008 Jun 9;.
- Associations of lower urinary...BJU Int. 2008 Jun 6;.
- [Prostate specific antigen: Utilization...Cancer Radiother. 2008 Jun 6;.
- An artificial neural network...BJU Int. 2008 Jun 3;.
- Association between serum prostate-specific...BJU Int. 2008 Jun 3;.
- Inverse Relationship Between Obesity...Urology. 2008 May 30;.
- The Comparability of Models...Eur Urol. 2008 May 22;.
- Quality of Life, Morbidity,...Clin Genitourin Cancer. 2008 Mar;6(1):46-52.
- Novel small molecule inhibitors...Prostate. 2008 May 23;.
- High Expression of KLK14...Tumour Biol. 2008;29(1):1-8. Epub 2008 May 23.
- Shorter CAG repeats in...Cancer Lett. 2008 May 19;.
- Detecting prostate cancer by...Eur J Clin Invest. 2008 Jun;38(6):430-7.
- Are prostate biopsies mandatory...Prostate. 2008 May 15;.
- Why determine only the...Ann Clin Biochem. 2008 May;45(Pt 3):270-4.
- Case records of the...N Engl J Med. 2008 May 15;358(20):2161-8.
- WHAT IS THE FUTURE...BJU Int. 2008 May 12;.
Structural Features
MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSL
FHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSI
EPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERP
SLYTKVVHYRKWIKDTIVANP
Cross annotation in other databases
KLK3/PSA in:
- Gene Cards
- Diseases
- Expression
- SNP
- Drugs
- Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS

