elastase-2
Functional Attributes in Pathways
-
Substrates : 93 entries in CutDB for S01.131
Ext
-
A-type flagellin
-
Actin, cytoplasmic 1
-
aggrecan 1 isoform 2 precursor
-
alpha-2-plasmin inhibitor
-
alpha1-antichymotrypsin (Homo sapiens)
-
apolipoprotein A-II preproprotein
-
cadherin 1
-
Cathelicidin antimicrobial peptide
-
chemokine (c-x-c motif) ligand 12 (stromal cell-derived factor 1) isoform beta
-
chemokine (C-X-C motif) receptor 4 isoform a
-
coagulation factor II (thrombin) receptor-like 1 precursor
-
coagulation factor II receptor precursor
-
Coagulation factor ii receptor precursor
-
coagulation factor IX preproprotein
-
coagulation factor V precursor
-
collagen alpha-1(III) chain precursor
-
colony stimulating factor 3 isoform c
-
complement component 1 inhibitor precursor
-
elafin preproprotein
-
flagellin
-
granulin precursor
-
heparin cofactor II precursor
-
IgG1 heavy chain (hinge region)
-
interleukin 1, beta proprotein [Homo sapiens]
-
IpaB, secreted by the Mxi-Spa secretion machinery, required for entry into epithelial cells
-
laminin, gamma 2 isoform a precursor
-
laminin, gamma 2 isoform b precursor
-
latent transforming growth factor beta binding protein 1 isoform LTBP-1L
-
latent transforming growth factor beta binding protein 1 isoform LTBP-1S
-
Lipoprotein, lp(a)
-
matrix metalloproteinase 2 preproprotein
-
metalloproteinase inhibitor
-
Notch homolog 2 N-terminal like protein
-
plasminogen activator, urokinase receptor isoform 1 precursor
-
plasminogen activator, urokinase receptor isoform 2 precursor
-
plasminogen activator, urokinase receptor isoform 3 precursor
-
platelet glycoprotein Ib alpha polypeptide precursor
-
promyelocytic leukemia protein isoform 6
-
pulmonary surfactant-associated protein D precursor
-
ribonuclease L
-
selectin P ligand
-
serine (or cysteine) proteinase inhibitor, clade A, member 7
-
serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 1
-
serine proteinase inhibitor, clade A, member 1
-
signal transducer and activator of transcription 3 isoform 1
-
sodium channel, nonvoltage-gated 1 gamma
-
surfactant protein A1
-
Tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor) isoform a
-
type I collagen
-
Tyrosyl-trna synthetase
-
urokinase plasminogen activator preproprotein
-
v-rel reticuloendotheliosis viral oncogene homolog A, nuclear factor of kappa light polypeptide gene enhancer in B-cells 3, p65
-
vascular cell adhesion molecule 1 isoform b precursor
-
virG invasion protein
-
Substrate Specificity -- Under development
-
Inhibitors -- Under development
-
Pathways -- Under development
Recent News and Literature
We currently do not have custom news for this protein.
Structural Features
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAV
RVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLG
RNRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
Cross annotation in other databases
elastase-2 in:
Gene Cards
- Diseases
- Expression
- SNP
- Drugs
Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS
Functional Attributes in Pathways
-
Substrates : 93 entries in CutDB for S01.131
Ext
- A-type flagellin
- Actin, cytoplasmic 1
- aggrecan 1 isoform 2 precursor
- alpha-2-plasmin inhibitor
- alpha1-antichymotrypsin (Homo sapiens)
- apolipoprotein A-II preproprotein
- cadherin 1
- Cathelicidin antimicrobial peptide
- chemokine (c-x-c motif) ligand 12 (stromal cell-derived factor 1) isoform beta
- chemokine (C-X-C motif) receptor 4 isoform a
- coagulation factor II (thrombin) receptor-like 1 precursor
- coagulation factor II receptor precursor
- Coagulation factor ii receptor precursor
- coagulation factor IX preproprotein
- coagulation factor V precursor
- collagen alpha-1(III) chain precursor
- colony stimulating factor 3 isoform c
- complement component 1 inhibitor precursor
- elafin preproprotein
- flagellin
- granulin precursor
- heparin cofactor II precursor
- IgG1 heavy chain (hinge region)
- interleukin 1, beta proprotein [Homo sapiens]
- IpaB, secreted by the Mxi-Spa secretion machinery, required for entry into epithelial cells
- laminin, gamma 2 isoform a precursor
- laminin, gamma 2 isoform b precursor
- latent transforming growth factor beta binding protein 1 isoform LTBP-1L
- latent transforming growth factor beta binding protein 1 isoform LTBP-1S
- Lipoprotein, lp(a)
- matrix metalloproteinase 2 preproprotein
- metalloproteinase inhibitor
- Notch homolog 2 N-terminal like protein
- plasminogen activator, urokinase receptor isoform 1 precursor
- plasminogen activator, urokinase receptor isoform 2 precursor
- plasminogen activator, urokinase receptor isoform 3 precursor
- platelet glycoprotein Ib alpha polypeptide precursor
- promyelocytic leukemia protein isoform 6
- pulmonary surfactant-associated protein D precursor
- ribonuclease L
- selectin P ligand
- serine (or cysteine) proteinase inhibitor, clade A, member 7
- serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 1
- serine proteinase inhibitor, clade A, member 1
- signal transducer and activator of transcription 3 isoform 1
- sodium channel, nonvoltage-gated 1 gamma
- surfactant protein A1
- Tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor) isoform a
- type I collagen
- Tyrosyl-trna synthetase
- urokinase plasminogen activator preproprotein
- v-rel reticuloendotheliosis viral oncogene homolog A, nuclear factor of kappa light polypeptide gene enhancer in B-cells 3, p65
- vascular cell adhesion molecule 1 isoform b precursor
- virG invasion protein
- Substrate Specificity -- Under development
- Inhibitors -- Under development
- Pathways -- Under development
Recent News and Literature
Structural Features
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAV
RVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLG
RNRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
Cross annotation in other databases
elastase-2 in:
- Gene Cards
- Diseases
- Expression
- SNP
- Drugs
- Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS

