granzyme B, human-type
Functional Attributes in Pathways
-
Substrates : 478 entries in CutDB for S01.010
Ext
-
A kinase (PRKA) anchor protein 8-like
-
100 kDa hexon-assembly associated protein
-
2',3'-cyclic nucleotide 3' phosphodiesterase
-
3'-terminal phosphate cyclase
-
40S ribosomal protein S11
-
40S ribosomal protein S15
-
40S ribosomal protein S15a
-
40S ribosomal protein S21
-
40S ribosomal protein S3a
-
40S ribosomal protein S4
-
40S ribosomal protein S7
-
40S ribosomal protein S8
-
6-phosphofructokinase, liver type
-
6-phosphofructokinase, muscle type
-
60S ribosomal protein L10
-
60S ribosomal protein L11
-
60S ribosomal protein L13
-
60S ribosomal protein L28
-
60S ribosomal protein L4
-
A kinase anchor protein 8
-
A-kinase anchor protein 8
-
acetyl-Coenzyme A carboxylase alpha
-
acidic (leucine-rich) nuclear phosphoprotein 32 family, member B
-
acidic (leucine-rich) nuclear phosphoprotein 32 family, member E
-
Acidic leucine-rich nuclear phosphoprotein 32 family member A
-
Acidic leucine-rich nuclear phosphoprotein 32 family member B
-
actin, beta
-
Actin, cytoplasmic 1
-
actin, gamma 2 propeptide
-
Actin, gamma-enteric smooth muscle
-
Actin-like protein 6A
-
activating transcription factor 7 interacting protein
-
ADP-ribosylation factor-like 6 interacting protein 4
-
alanyl-tRNA synthetase
-
Alpha-enolase
-
ankyrin 1 isoform 1
-
ankyrin repeat and KH domain containing 1 isoform 1
-
ankyrin repeat and KH domain containing 1 isoform 2
-
ankyrin repeat and KH domain containing 1 isoform 3
-
ankyrin repeat domain protein 17 isoform a
-
ankyrin repeat domain protein 17 isoform b
-
antigen identified by monoclonal antibody Ki-67 isoform 1
-
antigen identified by monoclonal antibody Ki-67 isoform 2
-
ataxin 3 isoform 1
-
ataxin 3 isoform 2
-
ataxin 3 isoform 3
-
ataxin 3 isoform 4
-
ATP synthase subunit alpha, mitochondrial precursor
-
ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit precursor
-
ATP-binding cassette sub-family F member 2
-
ATP-binding cassette, sub-family F (GCN20), member 1
-
ATP-binding cassette, sub-family F (GCN20), member 2
-
BCL2-associated athanogene isoform 1L
-
BCL2-associated transcription factor 1 isoform 1
-
BCL2/adenovirus E1B 19kD interacting protein 2
-
BH3 interacting domain death agonist isoform 1
-
Bh3 interacting domain death agonist isoform 2
-
biorientation of chromosomes in cell division 1-like
-
BMS1-like, ribosome assembly protein
-
calcium/calmodulin-dependent protein kinase IV
-
caspase 10 isoform a preproprotein
-
caspase 10 isoform b preproprotein
-
Caspase 10 isoform d preproprotein
-
Caspase 3 preproprotein
-
caspase 7 isoform alpha precursor
-
Caspase 7 isoform delta
-
caspase 8 isoform A precursor
-
caspase 8 isoform B precursor
-
caspase 8 isoform C precursor
-
caspase 8 isoform G precursor
-
Caspase 9 isoform alpha preproprotein
-
Cell death regulator Aven
-
Cell division cycle 5-like protein
-
cell division cycle associated 5
-
centromere protein B
-
chaperonin
-
chromodomain helicase DNA binding protein 4
-
chromodomain helicase DNA binding protein 7
-
Chromodomain-helicase-DNA-binding protein 4
-
Clathrin light chain B
-
cleavage and polyadenylation specific factor 6
-
CLIP-associating protein 1 isoform 1
-
coiled-coil domain containing 104
-
conserved nuclear protein Nhn1 isoform a
-
conserved nuclear protein Nhn1 isoform b
-
cyclin-dependent kinase inhibitor 1A
-
cytokine induced apoptosis inhibitor 1
-
D4, zinc and double PHD fingers family 2
-
DEAD (Asp-Glu-Ala-Asp) box polypeptide 1
-
DEAD (Asp-Glu-Ala-Asp) box polypeptide 21
-
DEAD (Asp-Glu-Ala-Asp) box polypeptide 50
-
DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 3
-
DEAH (Asp-Glu-Ala-His) box polypeptide 38
-
DEAH (Asp-Glu-Ala-His) box polypeptide 8
-
death inducer-obliterator 1 isoform 2
-
death inducer-obliterator 1 isoform 3
-
dedicator of cyto-kinesis 2
-
delangin isoform A
-
delangin isoform B
-
dihydrolipoamide S-acetyltransferase (E2 component of pyruvate dehydrogenase complex)
-
DNA fragmentation factor subunit alpha
-
Dna fragmentation factor, 45kda, alpha polypeptide isoform 1
-
DNA fragmentation factor, 45kDa, alpha polypeptide isoform 2
-
DNA mismatch repair protein Msh6
-
DNA polymerase delta catalytic subunit
-
DNA replication licensing factor MCM2
-
DNA replication licensing factor MCM3
-
DNA replication licensing factor MCM5
-
DNA topoisomerase 1
-
DNA topoisomerase I
-
DNA-dependent protein kinase catalytic subunit
-
DNA-directed DNA polymerase delta 4
-
DNA-directed RNA polymerase I A
-
DNA-directed RNA polymerase I subunit RPA1
-
DnaJ homolog subfamily C member 7
-
DnaJ homolog, subfamily C, member 9
-
Double-strand break repair protein MRE11A
-
Dynactin subunit 2
-
E3 ubiquitin-protein ligase HUWE1
-
Elongation factor 1-alpha 1
-
elongation factor Tu GTP binding domain containing 2 isoform a
-
elongation factor Tu GTP binding domain containing 2 isoform b
-
Endoplasmin
-
enhancer of mRNA decapping 3
-
enolase 1, alpha non-neuron
-
ErbB3-binding protein 1
-
eukaryotic translation initiation factor 2 subunit 2
-
eukaryotic translation initiation factor 3, subunit 1 alpha, 35kDa
-
eukaryotic translation initiation factor 3, subunit 10 (theta)
-
eukaryotic translation initiation factor 3, subunit J
-
Eukaryotic translation initiation factor 4 gamma 1
-
eukaryotic translation initiation factor 4, gamma 2 isoform 1
-
eukaryotic translation initiation factor 4, gamma 2 isoform 2
-
eukaryotic translation initiation factor 4H
-
Eukaryotic translation initiation factor 5A-1
-
Exportin-5
-
fibrillarin
-
fibronectin 1 isoform 1 preproprotein
-
filamin A, alpha
-
FK506 binding protein 5
-
Flt3 interacting zinc finger protein 1
-
fragile X mental retardation-related protein 2
-
FtsJ homolog 3
-
G protein-coupled receptor kinase interacting ArfGAP 2 isoform 1
-
G protein-coupled receptor kinase interacting ArfGAP 2 isoform 2
-
G protein-coupled receptor kinase interacting ArfGAP 2 isoform 3
-
gamma-taxilin
-
general transcription factor II E, polypeptide 1 (alpha subunit)
-
general transcription factor III C 1
-
Glutamate receptor 3 isoform flop precursor
-
glutamate-rich 1
-
GTP binding protein 1
-
GTP binding protein 4
-
H2A histone family, member Z
-
HBS1-like protein
-
heat shock 70kD protein binding protein
-
heat shock 90kDa protein 1, alpha isoform 1
-
heat shock 90kDa protein 1, beta
-
heat shock protein beta-1
-
helicase (DNA) B
-
hematopoietic cell specific Lyn substrate 1
-
hepatoma-derived growth factor-related protein 2
-
Heterogeneous nuclear ribonucleoprotein A3
-
heterogeneous nuclear ribonucleoprotein C
-
heterogeneous nuclear ribonucleoprotein F
-
heterogeneous nuclear ribonucleoprotein K
-
Heterogeneous nuclear ribonucleoprotein K
-
heterogeneous nuclear ribonucleoprotein M isoform a
-
heterogeneous nuclear ribonucleoprotein M isoform b
-
heterogeneous nuclear ribonucleoprotein U
-
hexamethylene bis-acetamide inducible 1
-
high mobility group nucleosomal binding domain 1
-
histidyl-tRNA synthetase
-
histone deacetylase 2
-
hnRNP-associated with lethal yellow long isoform
-
hnRNP-associated with lethal yellow short isoform
-
IK cytokine
-
Isoleucyl-tRNA synthetase, cytoplasmic
-
IST1 homolog
-
IWS1 homolog
-
janus kinase and microtubule interacting protein 1
-
karyopherin alpha 4
-
KH-type splicing regulatory protein
-
kinesin family member 4
-
la related protein
-
Lamin b1
-
laminin alpha 5
-
lens epithelium-derived growth factor
-
leucine rich repeat (in FLII) interacting protein 1 isoform 1
-
leupaxin
-
LTV1 homolog
-
LUC7-like 2
-
Lupus La protein (Sjoegren syndrome type B antigen)
-
Ly1 antibody reactive clone
-
M phase phosphoprotein 6
-
matrin 3
-
microtubule-associated protein 4
-
midasin
-
minichromosome maintenance deficient 3
-
mitogen-activated protein kinase kinase 6
-
Mki67 (FHA domain) interacting nucleolar phosphoprotein
-
mutS homolog 6
-
MYB binding protein (P160) 1a
-
Myb-binding protein 1A
-
myeloid cell leukemia sequence 1 isoform 1
-
myosin XVIIIA
-
NMD3 homolog
-
nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 interacting protein
-
nuclear mitotic apparatus protein 1
-
nuclease sensitive element binding protein 1
-
Nuclease-sensitive element-binding protein 1
-
nucleolar complex associated 2 homolog
-
nucleolar protein 5A
-
nucleolar TGF-beta1 target protein
-
Nucleolin
-
nucleolin
-
Nucleolin (Protein C23)
-
nucleophosmin 1 isoform 1
-
nucleophosmin 1 isoform 2
-
nucleophosmin 1 isoform 3
-
nucleoside-triphosphatase C1orf57
-
Numa protein
-
opioid growth factor receptor
-
otubain 1
-
p66 alpha isoform a
-
p66 alpha isoform b
-
pallidin
-
papillary renal cell carcinoma translocation-associated gene product
-
partner of NOB1
-
PDGFA associated protein 1
-
PDZ and LIM domain 2
-
pericentriolar material 1
-
peter pan homolog
-
PHD finger protein 3
-
phosphofructokinase, liver, B-type
-
phosphofructokinase, platelet
-
pinin
-
Poly (adp-ribose) polymerase family, member 1
-
polyglutamine binding protein 1
-
Polyglutamine-binding protein 1
-
polypyrimidine tract binding protein 1 isoform 1
-
polypyrimidine tract binding protein 1 isoform 2
-
Polypyrimidine tract-binding protein 1
-
postmeiotic segregation 1 isoform a
-
postmeiotic segregation 1 isoform b
-
postmeiotic segregation 1 isoform c
-
postmeiotic segregation increased 2 isoform a
-
procaspase 3
-
procaspase 7
-
proteasome 26S ATPase subunit 2
-
proteasome 26S ATPase subunit 4 isoform 1
-
proteasome 26S ATPase subunit 4 isoform 2
-
proteasome 26S non-ATPase subunit 12
-
protein FAM111A
-
protein kinase C substrate 80K-H
-
Protein kinase, dna-activated, catalytic polypeptide
-
protein LOC66523
-
protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform
-
Prothymosin alpha
-
prothymosin alpha
-
PRP3 pre-mRNA processing factor 3 homolog
-
PRP38 pre-mRNA processing factor 38 (yeast) domain containing A
-
PTK2 protein tyrosine kinase 2 isoform a
-
RAN binding protein 2
-
RD RNA-binding protein
-
restin
-
RGD motif, leucine rich repeats, tropomodulin domain and proline-rich containing
-
Rho GTPase activating protein 15 isoform 1
-
Rho GTPase activating protein 15 isoform 2
-
Rho guanine nucleotide exchange factor (GEF) 1 isoform b
-
Rho guanine nucleotide exchange factor (GEF) 1 isoform c
-
Rho-associated, coiled-coil containing protein kinase 2
-
ribosomal L1 domain containing 1
-
ribosomal protein L17
-
ribosomal protein L18
-
ribosomal protein L23
-
ribosomal protein L24-like
-
ribosomal protein L26-like 1
-
ribosomal protein L3
-
ribosomal protein L35
-
ribosomal protein L4
-
ribosomal protein L5
-
ribosomal protein L6
-
ribosomal protein P0
-
ribosomal protein S13
-
ribosomal protein S15
-
ribosomal protein S27
-
ribosomal protein S4, X-linked
-
ribosomal protein S7
-
ribosomal RNA processing 12 homolog
-
ribosomal RNA processing 8, methyltransferase, homolog
-
RNA binding motif protein 10
-
RNA binding motif protein 34
-
RNA binding motif protein 5
-
RNA binding motif protein 8a isoform a
-
RNA binding motif protein 8a isoform b
-
RNA polymerase II subunit 5-mediating protein
-
RNA polymerase II transcriptional coactivator
-
RNA U, small nuclear RNA export adapter protein
-
ROD1 regulator of differentiation 1
-
RRP15-like protein
-
RRS1 ribosome biogenesis regulator homolog
-
serine/arginine repetitive matrix 2
-
serine/threonine kinase 2
-
serine/threonine kinase 3
-
Serine/threonine-protein kinase N1
-
SERPINE1 mRNA binding protein 1 isoform 1
-
SERPINE1 mRNA binding protein 1 isoform 2
-
SERPINE1 mRNA binding protein 1 isoform 3
-
SERPINE1 mRNA binding protein 1 isoform 4
-
SET binding factor 1
-
SET domain containing 2
-
signal-induced proliferation associated gene 1
-
SKI interacting protein
-
splicing factor 3b, subunit 1
-
splicing factor 3b, subunit 2
-
Splicing factor U2AF 65 kDa subunit
-
splicing factor, arginine/serine-rich 8
-
squamous cell carcinoma antigen recognized by T-cells 3
-
Striatin
-
suppressor of S. cerevisiae gcr2
-
suppressor of Ty 6 homolog
-
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a4
-
T-cell receptor zeta chain isoform 1 precursor
-
T-cell receptor zeta chain isoform 2 precursor
-
taxilin
-
tetratricopeptide repeat domain 39B
-
tetratricopeptide repeat domain 4
-
transcription elongation factor A (SII) 1 isoform 1
-
transcription elongation factor A (SII) 1 isoform 2
-
transcription elongation factor A (SII) 1 isoform 3
-
treacle
-
Tubulin alpha-1A chain
-
tubulin folding cofactor A
-
Tubulin gamma-1 chain
-
tubulin, alpha 1a
-
U1 small nuclear ribonucleoprotein 70 kDa
-
U2 small nuclear ribonucleoprotein auxiliary factor (U2AF) 2
-
U3 snoRNP-associated protein
-
ubiquitin carboxyl-terminal hydrolase L5 isoform 1
-
ubiquitin carboxyl-terminal hydrolase L5 isoform 2
-
Ubiquitin conjugation factor E4 B
-
ubiquitin interaction motif containing 1
-
ubiquitin-conjugating enzyme E2O
-
Ubiquitination factor e4a
-
Uncharacterized protein KIAA0515
-
UTP18, small subunit processome component
-
UV excision repair protein RAD23 homolog A
-
vimentin
-
vitronectin precursor
-
Vpr-binding protein
-
Vps20-associated 1 homolog (S. cerevisiae)
-
WD repeat domain 55
-
Werner helicase interacting protein isoform 1
-
Werner helicase interacting protein isoform 2
-
WNK lysine deficient protein kinase 1
-
Wolf-Hirschhorn syndrome candidate 1
-
X-ray repair cross complementing protein 4 isoform 1
-
Yip1 domain family, member 4
-
zinc finger CCCH-type containing 4
-
Zinc finger CCHC domain-containing protein 8
-
zinc finger protein 191
-
zinc finger protein 295 isoform 1
-
zinc finger protein 295 isoform 2
-
zinc finger protein 295 isoform 3
-
zinedin isoform 1
-
zinedin isoform 2
-
ZW10 interacting protein-1
-
Substrate Specificity -- Under development
-
Inhibitors -- Under development
-
Pathways -- Under development
Recent News and Literature
We currently do not have custom news for this protein.
Structural Features
MQPILLLLAFLLLPRADAGEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIQDDFVLTAAHCWGSSINVTLGAHNIK
EQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTL
QEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWI
KKTMKRY
Cross annotation in other databases
granzyme B, human-type in:
Gene Cards
- Diseases
- Expression
- SNP
- Drugs
Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS
Functional Attributes in Pathways
-
Substrates : 478 entries in CutDB for S01.010
Ext
- A kinase (PRKA) anchor protein 8-like
- 100 kDa hexon-assembly associated protein
- 2',3'-cyclic nucleotide 3' phosphodiesterase
- 3'-terminal phosphate cyclase
- 40S ribosomal protein S11
- 40S ribosomal protein S15
- 40S ribosomal protein S15a
- 40S ribosomal protein S21
- 40S ribosomal protein S3a
- 40S ribosomal protein S4
- 40S ribosomal protein S7
- 40S ribosomal protein S8
- 6-phosphofructokinase, liver type
- 6-phosphofructokinase, muscle type
- 60S ribosomal protein L10
- 60S ribosomal protein L11
- 60S ribosomal protein L13
- 60S ribosomal protein L28
- 60S ribosomal protein L4
- A kinase anchor protein 8
- A-kinase anchor protein 8
- acetyl-Coenzyme A carboxylase alpha
- acidic (leucine-rich) nuclear phosphoprotein 32 family, member B
- acidic (leucine-rich) nuclear phosphoprotein 32 family, member E
- Acidic leucine-rich nuclear phosphoprotein 32 family member A
- Acidic leucine-rich nuclear phosphoprotein 32 family member B
- actin, beta
- Actin, cytoplasmic 1
- actin, gamma 2 propeptide
- Actin, gamma-enteric smooth muscle
- Actin-like protein 6A
- activating transcription factor 7 interacting protein
- ADP-ribosylation factor-like 6 interacting protein 4
- alanyl-tRNA synthetase
- Alpha-enolase
- ankyrin 1 isoform 1
- ankyrin repeat and KH domain containing 1 isoform 1
- ankyrin repeat and KH domain containing 1 isoform 2
- ankyrin repeat and KH domain containing 1 isoform 3
- ankyrin repeat domain protein 17 isoform a
- ankyrin repeat domain protein 17 isoform b
- antigen identified by monoclonal antibody Ki-67 isoform 1
- antigen identified by monoclonal antibody Ki-67 isoform 2
- ataxin 3 isoform 1
- ataxin 3 isoform 2
- ataxin 3 isoform 3
- ataxin 3 isoform 4
- ATP synthase subunit alpha, mitochondrial precursor
- ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit precursor
- ATP-binding cassette sub-family F member 2
- ATP-binding cassette, sub-family F (GCN20), member 1
- ATP-binding cassette, sub-family F (GCN20), member 2
- BCL2-associated athanogene isoform 1L
- BCL2-associated transcription factor 1 isoform 1
- BCL2/adenovirus E1B 19kD interacting protein 2
- BH3 interacting domain death agonist isoform 1
- Bh3 interacting domain death agonist isoform 2
- biorientation of chromosomes in cell division 1-like
- BMS1-like, ribosome assembly protein
- calcium/calmodulin-dependent protein kinase IV
- caspase 10 isoform a preproprotein
- caspase 10 isoform b preproprotein
- Caspase 10 isoform d preproprotein
- Caspase 3 preproprotein
- caspase 7 isoform alpha precursor
- Caspase 7 isoform delta
- caspase 8 isoform A precursor
- caspase 8 isoform B precursor
- caspase 8 isoform C precursor
- caspase 8 isoform G precursor
- Caspase 9 isoform alpha preproprotein
- Cell death regulator Aven
- Cell division cycle 5-like protein
- cell division cycle associated 5
- centromere protein B
- chaperonin
- chromodomain helicase DNA binding protein 4
- chromodomain helicase DNA binding protein 7
- Chromodomain-helicase-DNA-binding protein 4
- Clathrin light chain B
- cleavage and polyadenylation specific factor 6
- CLIP-associating protein 1 isoform 1
- coiled-coil domain containing 104
- conserved nuclear protein Nhn1 isoform a
- conserved nuclear protein Nhn1 isoform b
- cyclin-dependent kinase inhibitor 1A
- cytokine induced apoptosis inhibitor 1
- D4, zinc and double PHD fingers family 2
- DEAD (Asp-Glu-Ala-Asp) box polypeptide 1
- DEAD (Asp-Glu-Ala-Asp) box polypeptide 21
- DEAD (Asp-Glu-Ala-Asp) box polypeptide 50
- DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 3
- DEAH (Asp-Glu-Ala-His) box polypeptide 38
- DEAH (Asp-Glu-Ala-His) box polypeptide 8
- death inducer-obliterator 1 isoform 2
- death inducer-obliterator 1 isoform 3
- dedicator of cyto-kinesis 2
- delangin isoform A
- delangin isoform B
- dihydrolipoamide S-acetyltransferase (E2 component of pyruvate dehydrogenase complex)
- DNA fragmentation factor subunit alpha
- Dna fragmentation factor, 45kda, alpha polypeptide isoform 1
- DNA fragmentation factor, 45kDa, alpha polypeptide isoform 2
- DNA mismatch repair protein Msh6
- DNA polymerase delta catalytic subunit
- DNA replication licensing factor MCM2
- DNA replication licensing factor MCM3
- DNA replication licensing factor MCM5
- DNA topoisomerase 1
- DNA topoisomerase I
- DNA-dependent protein kinase catalytic subunit
- DNA-directed DNA polymerase delta 4
- DNA-directed RNA polymerase I A
- DNA-directed RNA polymerase I subunit RPA1
- DnaJ homolog subfamily C member 7
- DnaJ homolog, subfamily C, member 9
- Double-strand break repair protein MRE11A
- Dynactin subunit 2
- E3 ubiquitin-protein ligase HUWE1
- Elongation factor 1-alpha 1
- elongation factor Tu GTP binding domain containing 2 isoform a
- elongation factor Tu GTP binding domain containing 2 isoform b
- Endoplasmin
- enhancer of mRNA decapping 3
- enolase 1, alpha non-neuron
- ErbB3-binding protein 1
- eukaryotic translation initiation factor 2 subunit 2
- eukaryotic translation initiation factor 3, subunit 1 alpha, 35kDa
- eukaryotic translation initiation factor 3, subunit 10 (theta)
- eukaryotic translation initiation factor 3, subunit J
- Eukaryotic translation initiation factor 4 gamma 1
- eukaryotic translation initiation factor 4, gamma 2 isoform 1
- eukaryotic translation initiation factor 4, gamma 2 isoform 2
- eukaryotic translation initiation factor 4H
- Eukaryotic translation initiation factor 5A-1
- Exportin-5
- fibrillarin
- fibronectin 1 isoform 1 preproprotein
- filamin A, alpha
- FK506 binding protein 5
- Flt3 interacting zinc finger protein 1
- fragile X mental retardation-related protein 2
- FtsJ homolog 3
- G protein-coupled receptor kinase interacting ArfGAP 2 isoform 1
- G protein-coupled receptor kinase interacting ArfGAP 2 isoform 2
- G protein-coupled receptor kinase interacting ArfGAP 2 isoform 3
- gamma-taxilin
- general transcription factor II E, polypeptide 1 (alpha subunit)
- general transcription factor III C 1
- Glutamate receptor 3 isoform flop precursor
- glutamate-rich 1
- GTP binding protein 1
- GTP binding protein 4
- H2A histone family, member Z
- HBS1-like protein
- heat shock 70kD protein binding protein
- heat shock 90kDa protein 1, alpha isoform 1
- heat shock 90kDa protein 1, beta
- heat shock protein beta-1
- helicase (DNA) B
- hematopoietic cell specific Lyn substrate 1
- hepatoma-derived growth factor-related protein 2
- Heterogeneous nuclear ribonucleoprotein A3
- heterogeneous nuclear ribonucleoprotein C
- heterogeneous nuclear ribonucleoprotein F
- heterogeneous nuclear ribonucleoprotein K
- Heterogeneous nuclear ribonucleoprotein K
- heterogeneous nuclear ribonucleoprotein M isoform a
- heterogeneous nuclear ribonucleoprotein M isoform b
- heterogeneous nuclear ribonucleoprotein U
- hexamethylene bis-acetamide inducible 1
- high mobility group nucleosomal binding domain 1
- histidyl-tRNA synthetase
- histone deacetylase 2
- hnRNP-associated with lethal yellow long isoform
- hnRNP-associated with lethal yellow short isoform
- IK cytokine
- Isoleucyl-tRNA synthetase, cytoplasmic
- IST1 homolog
- IWS1 homolog
- janus kinase and microtubule interacting protein 1
- karyopherin alpha 4
- KH-type splicing regulatory protein
- kinesin family member 4
- la related protein
- Lamin b1
- laminin alpha 5
- lens epithelium-derived growth factor
- leucine rich repeat (in FLII) interacting protein 1 isoform 1
- leupaxin
- LTV1 homolog
- LUC7-like 2
- Lupus La protein (Sjoegren syndrome type B antigen)
- Ly1 antibody reactive clone
- M phase phosphoprotein 6
- matrin 3
- microtubule-associated protein 4
- midasin
- minichromosome maintenance deficient 3
- mitogen-activated protein kinase kinase 6
- Mki67 (FHA domain) interacting nucleolar phosphoprotein
- mutS homolog 6
- MYB binding protein (P160) 1a
- Myb-binding protein 1A
- myeloid cell leukemia sequence 1 isoform 1
- myosin XVIIIA
- NMD3 homolog
- nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 interacting protein
- nuclear mitotic apparatus protein 1
- nuclease sensitive element binding protein 1
- Nuclease-sensitive element-binding protein 1
- nucleolar complex associated 2 homolog
- nucleolar protein 5A
- nucleolar TGF-beta1 target protein
- Nucleolin
- nucleolin
- Nucleolin (Protein C23)
- nucleophosmin 1 isoform 1
- nucleophosmin 1 isoform 2
- nucleophosmin 1 isoform 3
- nucleoside-triphosphatase C1orf57
- Numa protein
- opioid growth factor receptor
- otubain 1
- p66 alpha isoform a
- p66 alpha isoform b
- pallidin
- papillary renal cell carcinoma translocation-associated gene product
- partner of NOB1
- PDGFA associated protein 1
- PDZ and LIM domain 2
- pericentriolar material 1
- peter pan homolog
- PHD finger protein 3
- phosphofructokinase, liver, B-type
- phosphofructokinase, platelet
- pinin
- Poly (adp-ribose) polymerase family, member 1
- polyglutamine binding protein 1
- Polyglutamine-binding protein 1
- polypyrimidine tract binding protein 1 isoform 1
- polypyrimidine tract binding protein 1 isoform 2
- Polypyrimidine tract-binding protein 1
- postmeiotic segregation 1 isoform a
- postmeiotic segregation 1 isoform b
- postmeiotic segregation 1 isoform c
- postmeiotic segregation increased 2 isoform a
- procaspase 3
- procaspase 7
- proteasome 26S ATPase subunit 2
- proteasome 26S ATPase subunit 4 isoform 1
- proteasome 26S ATPase subunit 4 isoform 2
- proteasome 26S non-ATPase subunit 12
- protein FAM111A
- protein kinase C substrate 80K-H
- Protein kinase, dna-activated, catalytic polypeptide
- protein LOC66523
- protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform
- Prothymosin alpha
- prothymosin alpha
- PRP3 pre-mRNA processing factor 3 homolog
- PRP38 pre-mRNA processing factor 38 (yeast) domain containing A
- PTK2 protein tyrosine kinase 2 isoform a
- RAN binding protein 2
- RD RNA-binding protein
- restin
- RGD motif, leucine rich repeats, tropomodulin domain and proline-rich containing
- Rho GTPase activating protein 15 isoform 1
- Rho GTPase activating protein 15 isoform 2
- Rho guanine nucleotide exchange factor (GEF) 1 isoform b
- Rho guanine nucleotide exchange factor (GEF) 1 isoform c
- Rho-associated, coiled-coil containing protein kinase 2
- ribosomal L1 domain containing 1
- ribosomal protein L17
- ribosomal protein L18
- ribosomal protein L23
- ribosomal protein L24-like
- ribosomal protein L26-like 1
- ribosomal protein L3
- ribosomal protein L35
- ribosomal protein L4
- ribosomal protein L5
- ribosomal protein L6
- ribosomal protein P0
- ribosomal protein S13
- ribosomal protein S15
- ribosomal protein S27
- ribosomal protein S4, X-linked
- ribosomal protein S7
- ribosomal RNA processing 12 homolog
- ribosomal RNA processing 8, methyltransferase, homolog
- RNA binding motif protein 10
- RNA binding motif protein 34
- RNA binding motif protein 5
- RNA binding motif protein 8a isoform a
- RNA binding motif protein 8a isoform b
- RNA polymerase II subunit 5-mediating protein
- RNA polymerase II transcriptional coactivator
- RNA U, small nuclear RNA export adapter protein
- ROD1 regulator of differentiation 1
- RRP15-like protein
- RRS1 ribosome biogenesis regulator homolog
- serine/arginine repetitive matrix 2
- serine/threonine kinase 2
- serine/threonine kinase 3
- Serine/threonine-protein kinase N1
- SERPINE1 mRNA binding protein 1 isoform 1
- SERPINE1 mRNA binding protein 1 isoform 2
- SERPINE1 mRNA binding protein 1 isoform 3
- SERPINE1 mRNA binding protein 1 isoform 4
- SET binding factor 1
- SET domain containing 2
- signal-induced proliferation associated gene 1
- SKI interacting protein
- splicing factor 3b, subunit 1
- splicing factor 3b, subunit 2
- Splicing factor U2AF 65 kDa subunit
- splicing factor, arginine/serine-rich 8
- squamous cell carcinoma antigen recognized by T-cells 3
- Striatin
- suppressor of S. cerevisiae gcr2
- suppressor of Ty 6 homolog
- SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a4
- T-cell receptor zeta chain isoform 1 precursor
- T-cell receptor zeta chain isoform 2 precursor
- taxilin
- tetratricopeptide repeat domain 39B
- tetratricopeptide repeat domain 4
- transcription elongation factor A (SII) 1 isoform 1
- transcription elongation factor A (SII) 1 isoform 2
- transcription elongation factor A (SII) 1 isoform 3
- treacle
- Tubulin alpha-1A chain
- tubulin folding cofactor A
- Tubulin gamma-1 chain
- tubulin, alpha 1a
- U1 small nuclear ribonucleoprotein 70 kDa
- U2 small nuclear ribonucleoprotein auxiliary factor (U2AF) 2
- U3 snoRNP-associated protein
- ubiquitin carboxyl-terminal hydrolase L5 isoform 1
- ubiquitin carboxyl-terminal hydrolase L5 isoform 2
- Ubiquitin conjugation factor E4 B
- ubiquitin interaction motif containing 1
- ubiquitin-conjugating enzyme E2O
- Ubiquitination factor e4a
- Uncharacterized protein KIAA0515
- UTP18, small subunit processome component
- UV excision repair protein RAD23 homolog A
- vimentin
- vitronectin precursor
- Vpr-binding protein
- Vps20-associated 1 homolog (S. cerevisiae)
- WD repeat domain 55
- Werner helicase interacting protein isoform 1
- Werner helicase interacting protein isoform 2
- WNK lysine deficient protein kinase 1
- Wolf-Hirschhorn syndrome candidate 1
- X-ray repair cross complementing protein 4 isoform 1
- Yip1 domain family, member 4
- zinc finger CCCH-type containing 4
- Zinc finger CCHC domain-containing protein 8
- zinc finger protein 191
- zinc finger protein 295 isoform 1
- zinc finger protein 295 isoform 2
- zinc finger protein 295 isoform 3
- zinedin isoform 1
- zinedin isoform 2
- ZW10 interacting protein-1
- Substrate Specificity -- Under development
- Inhibitors -- Under development
- Pathways -- Under development
Recent News and Literature
Structural Features
MQPILLLLAFLLLPRADAGEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIQDDFVLTAAHCWGSSINVTLGAHNIK
EQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTL
QEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWI
KKTMKRY
Cross annotation in other databases
granzyme B, human-type in:
- Gene Cards
- Diseases
- Expression
- SNP
- Drugs
- Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS

