MMP3
Functional Attributes in Pathways
-
Substrates : 247 entries in CutDB for M10.005
Ext
-
Aggrecan 1 isoform 2 precursor
-
agrin
-
alpha 1 type II collagen isoform 1
-
alpha 1 type II collagen isoform 2 precursor
-
alpha 1 type XVIII collagen isoform 1 precursor
-
alpha-2-HS-glycoprotei
-
alpha-synuclein isoform NACP140
-
alpha1-antichymotrypsin (Homo sapiens)
-
alpha1-proteinase inhibitor (Homo sapiens)
-
alpha2-antiplasmin (Homo sapiens)
-
alpha2-macroglobulin (Homo sapiens)
-
antithrombin III (Homo sapiens)
-
apolipoprotein A-I preproprotein
-
biglycan preproprotein
-
Brevican core protein precursor
-
cadherin 1
-
Cartilage linking protein 1
-
chemokine (C-C motif) ligand 7 precursor
-
chemokine (C-C motif) ligand 8
-
chondroitin sulfate proteoglycan 2 (versican)
-
clusterin isoform 1
-
clusterin isoform 2
-
collagen alpha1 (II) (Bos taurus)
-
collagen alpha1 (IV) (Bos taurus)
-
collagen type III alpha 1 preproprotein
-
collagen, type II, alpha 1 isoform 1 precursor
-
collagen, type II, alpha 1 isoform 2 precursor
-
collagen, type IX, alpha 3
-
collagenase 2 precursor (Homo sapiens)
-
collagenase 3 precursor (Homo sapiens)
-
complement component 1, q subcomponent, A chain
-
complement component 1, q subcomponent, B chain
-
connective tissue growth factor
-
decorin (Homo sapiens)
-
decorin isoform b precursor
-
decorin isoform c precursor
-
fibrillin 1 precursor
-
fibrinogen, alpha polypeptide isoform alpha preproprotein
-
fibrinogen, alpha polypeptide isoform alpha-E preproprotein
-
fibrinogen, beta chain preproprotein
-
fibrinogen, gamma chain isoform gamma-A precursor
-
fibrinogen, gamma chain isoform gamma-B precursor
-
fibromodulin precursor
-
fibronectin (Homo sapiens)
-
fibronectin 1 isoform 1 preproprotein
-
fibronectin 1 isoform 2 preproprotein
-
fibronectin 1 isoform 3 preproprotein
-
fibronectin 1 isoform 4 preproprotein
-
fibronectin 1 isoform 5 preproprotein
-
fibronectin 1 isoform 6 preproprotein
-
fibronectin 1 isoform 7 preproprotein
-
fibulin-2 (Mus musculus)
-
Gelsolin isoform a precursor
-
gelsolin isoform b
-
heparan sulfate proteoglycan core protein
-
heparin-binding EGF growth factor
-
IgG1 heavy chain (hinge region)
-
IGHG1 protein
-
insulin-like growth factor binding protein 1 isoform a precursor
-
Insulin-like growth factor binding protein 3 isoform b precursor
-
laminin, gamma 2
-
matrilysin precursor (Homo sapiens)
-
matrix metallopeptidase-9
-
matrix metalloproteinase 1 preproprotein
-
matrix metalloproteinase 13 preproprotein
-
matrix metalloproteinase 3 preproprotein
-
matrix metalloproteinase 9 preproprotein
-
Monocyte chemoattractant protein (mcp-3)
-
monocyte chemoattractant protein-1 (Homo sapiens)
-
monocyte chemoattractant protein-2 (Homo sapiens)
-
monocyte chemoattractant protein-3 (Homo sapiens)
-
monocyte chemoattractant protein-4 (Homo sapiens)
-
nidogen (Mus musculus)
-
osteopontin (Homo sapiens)
-
osteopontin (Rattus norvegicus)
-
ovostatin (Gallus gallus)
-
Plasminogen
-
plasminogen (Homo sapiens)
-
Plasminogen activator inhibitor-1
-
plasminogen activator inhibitor-1 (Homo sapiens)
-
Plasminogen activator, urokinase receptor isoform 1 precursor
-
PREDICTED: similar to Collagen alpha-1(XI) chain isoform 1
-
prolactin
-
proline arginine-rich end leucine-rich repeat protein precursor
-
secreted phosphoprotein 1 isoform a
-
secreted protein, acidic, cysteine-rich (osteonectin)
-
selectin L
-
serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
-
serpin peptidase inhibitor, clade A, member 3 precursor
-
serum amyloid A1 isoform 1
-
Serum amyloid a2
-
similar to alpha 3 type IX collagen
-
similar to Collagen alpha 1(IX) chain precursor, partial
-
similar to Collagen alpha 2(IX) chain precursor
-
skin collagenase precursor
-
Small inducible cytokine a13 precursor
-
Small inducible cytokine a2 precursor
-
Small inducible cytokine a8 precursor
-
stromelysin 1 precursor (Homo sapiens)
-
substance P
-
u-plasminogen activator (Homo sapiens)
-
vascular endothelial growth factor A isoform 2 precursor
-
vascular endothelial growth factor A isoform 5
-
vitronectin precursor
-
Substrate Specificity -- Under development
-
Inhibitors -- Under development
-
Pathways -- Under development
Recent News and Literature
- Spontaneous metastasis in matrix...Mol Carcinog. 2008 Dec 4.
- Cordycepin inhibits IL-1{beta}-induced MMP-1...Rheumatology (Oxford). 2009 Jan;48(1):45-48.
- Matrix metalloproteinase-1 is a crucial...Oncol Rep. 2008 Dec;20(6):1497-1504.
- Expression of the metalloproteases...World J Surg Oncol. 2008 Oct 27;6(1):114.
- Serum levels of biomarkers...Arthritis Res Ther. 2008 Oct 22;10(5):R125.
- Herniated and spondylotic intervertebral...J Neurosurg Spine. 2008 Sep;9(3):285-95.
- Mechanism of Signal Transduction...Spine. 2008 Oct 14.
- Increased levels of soluble...Biomed Pharmacother. 2008 Sep 17.
- Keratinocyte expression of MMP3...Am J Pathol. 2008 Nov;173(5):1528-39. Epub 2008 Oct 2.
- Comedo-ductal carcinoma in situ:...Cancer Biol Ther. 2008 Nov 12;7(11).
- No Association of MMP-7,...Cancer Epidemiol Biomarkers Prev. 2008 Sep;17(9):2514-8.
- IL-20 may contribute to the pathogenesis...Spine. 2008 Sep 1;33(19):2034-40.
- Up-regulation of matrix metalloproteinase-3...Cancer Sci. 2008 Aug;99(8):1618-25.
- [Clinical study of etanercept...Nan Fang Yi Ke Da Xue Xue Bao. 2008 Aug;28(8):1349-51.
- Soluble intercellular adhesion molecule-1...J Heart Valve Dis. 2008 Jul;17(4):388-95.
- Gene polymorphisms related to angiogenesis,...Oral Oncol. 2008 Jul 30.
- The clinical implications of increased...Clin Chim Acta. 2008 Nov;397(1-2):22-6. Epub 2008 Jul 12.
- Dexamethasone prevents alteration of tight...Brain Res. 2008 Sep 10;1229:1-17. Epub 2008 Jul 8.
- Ultraviolet Radiation and the Role...Invest Ophthalmol Vis Sci. 2008 Jul 18.
- Polymorphisms in the estrogen...PLoS ONE. 2008 Jun 30;3(7):e2816.
Structural Features
MKSLPILLLLCVAVCSAYPLDGAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKDSGPVVKKIREMQKFLGLEVTGKLD
SDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIM
ISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLY
HSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLR
KLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKT
YFFVEDKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC
Cross annotation in other databases
MMP3 in:
Gene Cards
- Diseases
- Expression
- SNP
- Drugs
Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS
Functional Attributes in Pathways
-
Substrates : 247 entries in CutDB for M10.005
Ext
- Aggrecan 1 isoform 2 precursor
- agrin
- alpha 1 type II collagen isoform 1
- alpha 1 type II collagen isoform 2 precursor
- alpha 1 type XVIII collagen isoform 1 precursor
- alpha-2-HS-glycoprotei
- alpha-synuclein isoform NACP140
- alpha1-antichymotrypsin (Homo sapiens)
- alpha1-proteinase inhibitor (Homo sapiens)
- alpha2-antiplasmin (Homo sapiens)
- alpha2-macroglobulin (Homo sapiens)
- antithrombin III (Homo sapiens)
- apolipoprotein A-I preproprotein
- biglycan preproprotein
- Brevican core protein precursor
- cadherin 1
- Cartilage linking protein 1
- chemokine (C-C motif) ligand 7 precursor
- chemokine (C-C motif) ligand 8
- chondroitin sulfate proteoglycan 2 (versican)
- clusterin isoform 1
- clusterin isoform 2
- collagen alpha1 (II) (Bos taurus)
- collagen alpha1 (IV) (Bos taurus)
- collagen type III alpha 1 preproprotein
- collagen, type II, alpha 1 isoform 1 precursor
- collagen, type II, alpha 1 isoform 2 precursor
- collagen, type IX, alpha 3
- collagenase 2 precursor (Homo sapiens)
- collagenase 3 precursor (Homo sapiens)
- complement component 1, q subcomponent, A chain
- complement component 1, q subcomponent, B chain
- connective tissue growth factor
- decorin (Homo sapiens)
- decorin isoform b precursor
- decorin isoform c precursor
- fibrillin 1 precursor
- fibrinogen, alpha polypeptide isoform alpha preproprotein
- fibrinogen, alpha polypeptide isoform alpha-E preproprotein
- fibrinogen, beta chain preproprotein
- fibrinogen, gamma chain isoform gamma-A precursor
- fibrinogen, gamma chain isoform gamma-B precursor
- fibromodulin precursor
- fibronectin (Homo sapiens)
- fibronectin 1 isoform 1 preproprotein
- fibronectin 1 isoform 2 preproprotein
- fibronectin 1 isoform 3 preproprotein
- fibronectin 1 isoform 4 preproprotein
- fibronectin 1 isoform 5 preproprotein
- fibronectin 1 isoform 6 preproprotein
- fibronectin 1 isoform 7 preproprotein
- fibulin-2 (Mus musculus)
- Gelsolin isoform a precursor
- gelsolin isoform b
- heparan sulfate proteoglycan core protein
- heparin-binding EGF growth factor
- IgG1 heavy chain (hinge region)
- IGHG1 protein
- insulin-like growth factor binding protein 1 isoform a precursor
- Insulin-like growth factor binding protein 3 isoform b precursor
- laminin, gamma 2
- matrilysin precursor (Homo sapiens)
- matrix metallopeptidase-9
- matrix metalloproteinase 1 preproprotein
- matrix metalloproteinase 13 preproprotein
- matrix metalloproteinase 3 preproprotein
- matrix metalloproteinase 9 preproprotein
- Monocyte chemoattractant protein (mcp-3)
- monocyte chemoattractant protein-1 (Homo sapiens)
- monocyte chemoattractant protein-2 (Homo sapiens)
- monocyte chemoattractant protein-3 (Homo sapiens)
- monocyte chemoattractant protein-4 (Homo sapiens)
- nidogen (Mus musculus)
- osteopontin (Homo sapiens)
- osteopontin (Rattus norvegicus)
- ovostatin (Gallus gallus)
- Plasminogen
- plasminogen (Homo sapiens)
- Plasminogen activator inhibitor-1
- plasminogen activator inhibitor-1 (Homo sapiens)
- Plasminogen activator, urokinase receptor isoform 1 precursor
- PREDICTED: similar to Collagen alpha-1(XI) chain isoform 1
- prolactin
- proline arginine-rich end leucine-rich repeat protein precursor
- secreted phosphoprotein 1 isoform a
- secreted protein, acidic, cysteine-rich (osteonectin)
- selectin L
- serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
- serpin peptidase inhibitor, clade A, member 3 precursor
- serum amyloid A1 isoform 1
- Serum amyloid a2
- similar to alpha 3 type IX collagen
- similar to Collagen alpha 1(IX) chain precursor, partial
- similar to Collagen alpha 2(IX) chain precursor
- skin collagenase precursor
- Small inducible cytokine a13 precursor
- Small inducible cytokine a2 precursor
- Small inducible cytokine a8 precursor
- stromelysin 1 precursor (Homo sapiens)
- substance P
- u-plasminogen activator (Homo sapiens)
- vascular endothelial growth factor A isoform 2 precursor
- vascular endothelial growth factor A isoform 5
- vitronectin precursor
- Substrate Specificity -- Under development
- Inhibitors -- Under development
- Pathways -- Under development
Recent News and Literature
- Spontaneous metastasis in matrix...Mol Carcinog. 2008 Dec 4.
- Cordycepin inhibits IL-1{beta}-induced MMP-1...Rheumatology (Oxford). 2009 Jan;48(1):45-48.
- Matrix metalloproteinase-1 is a crucial...Oncol Rep. 2008 Dec;20(6):1497-1504.
- Expression of the metalloproteases...World J Surg Oncol. 2008 Oct 27;6(1):114.
- Serum levels of biomarkers...Arthritis Res Ther. 2008 Oct 22;10(5):R125.
- Herniated and spondylotic intervertebral...J Neurosurg Spine. 2008 Sep;9(3):285-95.
- Mechanism of Signal Transduction...Spine. 2008 Oct 14.
- Increased levels of soluble...Biomed Pharmacother. 2008 Sep 17.
- Keratinocyte expression of MMP3...Am J Pathol. 2008 Nov;173(5):1528-39. Epub 2008 Oct 2.
- Comedo-ductal carcinoma in situ:...Cancer Biol Ther. 2008 Nov 12;7(11).
- No Association of MMP-7,...Cancer Epidemiol Biomarkers Prev. 2008 Sep;17(9):2514-8.
- IL-20 may contribute to the pathogenesis...Spine. 2008 Sep 1;33(19):2034-40.
- Up-regulation of matrix metalloproteinase-3...Cancer Sci. 2008 Aug;99(8):1618-25.
- [Clinical study of etanercept...Nan Fang Yi Ke Da Xue Xue Bao. 2008 Aug;28(8):1349-51.
- Soluble intercellular adhesion molecule-1...J Heart Valve Dis. 2008 Jul;17(4):388-95.
- Gene polymorphisms related to angiogenesis,...Oral Oncol. 2008 Jul 30.
- The clinical implications of increased...Clin Chim Acta. 2008 Nov;397(1-2):22-6. Epub 2008 Jul 12.
- Dexamethasone prevents alteration of tight...Brain Res. 2008 Sep 10;1229:1-17. Epub 2008 Jul 8.
- Ultraviolet Radiation and the Role...Invest Ophthalmol Vis Sci. 2008 Jul 18.
- Polymorphisms in the estrogen...PLoS ONE. 2008 Jun 30;3(7):e2816.
Structural Features
MKSLPILLLLCVAVCSAYPLDGAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKDSGPVVKKIREMQKFLGLEVTGKLD
SDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIM
ISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLY
HSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLR
KLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKT
YFFVEDKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC
Cross annotation in other databases
MMP3 in:
- Gene Cards
- Diseases
- Expression
- SNP
- Drugs
- Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS
© The PMAP Web Site is managed by The Center on Proteolytic Pathways at the Burnham Institute for Medical Research through a grant from the NIH Roadmap.
Copyright 2008. All rights reserved.
The Burnham Institute for Medical Research 10901 N. Torrey Pines Rd., La Jolla, CA 92037.
With problems, comments, or suggestions please contact: pmap_info@burnham.org